PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Thhalv10018065m
Common NameEUTSA_v10018065mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Eutremeae; Eutrema
Family SBP
Protein Properties Length: 1007aa    MW: 111365 Da    PI: 7.9366
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Thhalv10018065mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP105.44.1e-331201821678
                      HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
              SBP  16 eyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                      +y +rhkvCe hska+++lv +++qrfCqqCsrfh lsefDe+krsCrrrLa+hn+rrrk+q+
  Thhalv10018065m 120 NYPKRHKVCELHSKATKALVGKQMQRFCQQCSRFHLLSEFDEGKRSCRRRLAGHNRRRRKTQP 182
                      799*********************************************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5114125.28291180IPR004333Transcription factor, SBP-box
SuperFamilySSF1036122.22E-29119185IPR004333Transcription factor, SBP-box
PfamPF031106.4E-24120179IPR004333Transcription factor, SBP-box
Gene3DG3DSA:4.10.1100.102.3E-22120167IPR004333Transcription factor, SBP-box
CDDcd002045.92E-5763897No hitNo description
Gene3DG3DSA:1.25.40.206.0E-6794911IPR020683Ankyrin repeat-containing domain
SuperFamilySSF484031.19E-6806900IPR020683Ankyrin repeat-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0016021Cellular Componentintegral component of membrane
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 1007 aa     Download sequence    Send to blast
MEEVGPQVAG PISIHHSIGR KRDLYQQPHW LVPSQPRNDW NPKMWEWDSQ RFEAKPVDGN  60
GTQFDVNARS NSNNNNGGLS YEGEERGLDL NLSTAVEDTP VVTRPNKKVR SGSPGSGGGN  120
YPKRHKVCEL HSKATKALVG KQMQRFCQQC SRFHLLSEFD EGKRSCRRRL AGHNRRRRKT  180
QPEEITSRVL APGNCDHTSS NANLDIMALL TALACAQGKN DAKPNGSPAV PQREQLLQIL  240
NKINALPLPM DLVSKLNNIG ILARKNLDQP SGMNPQKDMD GASSPSTMDL LAVLSTTLGS  300
SAPEAIALLS QGEFGTKESE DKTKLTSCDH ATTTNLEKRA LEFPSFGGGE RSSSSNPSPS  360
QDSDSHAQDT RSSLSLQLFT SSPEDESQPT VASSRKYYSS ASSNPVEDRS PSSSPVMQEL  420
FPLQTSPETM RSNNSKNSSP SPRTSCLPLE LFGASDRGAV TNPNFNHSRH QSEYASSGSN  480
YSPPSLNSDA QFSNYLEKNP SQLPGTLRTE IYSWLSSIPS EMESYIRSGC VILSVYVAMS  540
ASAWEQLEEN LLQRVSTLVQ DSEFWSNTRF LVNTGRQLAS YKHGKIRLSK SWRTLSSPEL  600
ITVSPLAVVA GEETTLLVRG RSLTNTGISF RCAHMGNYAS MEVAGTKHRS TKFDELYVNS  660
FKVESGIPDS LGRCFLEVEN GFRSDSFPLI IANATICKEL NRLEDEFHPK DATEEQIHNS  720
YRPRSRDEVL CFLNELGWLF QRKWTSDTHG ESDFSLPRFK FLLVCSVERD YCSLIRTLLD  780
MMVERNLGKD GLMNKESLDM LAEIQLLNRA VKRRNTKMAE TLIHYSANPT TKKFIFVPNI  840
AGPGDITTLH LAASTSGSED MIDVLTNDPQ EIGLSCWNTL IDASGQTPFS YAAMRNNHSY  900
NTLVARKLAD KRNGQISLNI ENGIDQIGLS KRLSSELKRS CNTCASVALK YQRKVSGSHR  960
LFPTPIIHSM LAVATVCVCV CVFMHAFPIV RQGSHFSWGG LDYGSI*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A8e-231211792684squamosa promoter binding protein-like 4
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1808813RAVKRR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAJ2429580.0AJ242958.1 Arabidopsis thaliana partial mRNA for SPL1-Related3 protein (SPL1R3 gene).
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006390175.10.0hypothetical protein EUTSA_v10018065mg
SwissprotQ700C20.0SPL16_ARATH; Squamosa promoter-binding-like protein 16
TrEMBLV4M8H60.0V4M8H6_EUTSA; Uncharacterized protein
STRINGscaffold_202615.10.0(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM39992554
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G76580.10.0SBP family protein